PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13976_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 74aa    MW: 8691.44 Da    PI: 4.2403
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13976_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-122868446
                                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         ++++E+el+++ +++ G + W++Ia +++ gRt++++  +w++
  cra_locus_13976_iso_2_len_707_ver_3 28 FSEDEEELIIRMFNLVGER-WSLIAGRIP-GRTAEEIERYWNS 68
                                         89*****************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5431674IPR017930Myb domain
SMARTSM007173.9E-92472IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-92870IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-142869IPR009057Homeodomain-like
PfamPF002493.5E-112868IPR001005SANT/Myb domain
CDDcd001671.21E-53567No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MADSEHSSSE EPFTYSPEKK GRDSEIEFSE DEEELIIRMF NLVGERWSLI AGRIPGRTAE  60
EIERYWNSRY STSQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317211.13e-37hypothetical protein POPTR_0011s00390g
SwissprotQ9LNI59e-18ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLB9HZL84e-37B9HZL8_POPTR; Uncharacterized protein
STRINGPOPTR_0011s00390.11e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932